Human TFPI protein

Catalog Number: orb604406

Catalog Number	orb604406
Category	Proteins
Description	Recombinant Human Tissue factor pathway inhibitor(TFPI),partial
Reactivity	Human
Tag	N-terminal GST-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	55.9 kDa
Target	TFPI
UniProt ID	P10646
Protein Sequence	DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL
Protein Length	Partial
Source	E.coli
Expression System	29-280aa
Expression Region	29-280aa
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	90%
MW:	30.0 kDa
Source:	Human TFPI, His Tag (orb257863) is expressed from human 293 cells (HEK293). It contains AA Asp 29 - Lys 282 (Accession # NP_006278.1).

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	31.8 kDa
Source:	in vitro E.coli expression system

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	46.8 kDa
Source:	in vitro E.coli expression system