Human RANKL protein

• Catalog Number: orb594839
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor ligand superfamily member 11(TNFSF11),partial (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
• Protein Length: Partial
• UniProt ID: O14788
• MW: 22.4 kDa
• Application notes: Partial
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: ①Loaded Recombinant Human OPG-Fc on Pro A Biosensor, can bind Human RANKL with an affinity constant of 1.83 pM as determined in BLI assay. ②Loaded Human RANK-His on HIS1K Biosensor, can bind Human RANK L with an affinity constant of <1 pM as determined in BLI assay.
• Expression Region: 140-317aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteocla
• Background: CD254, also known as RANKL, TNFSF11, TRANCE, OPGL
• Research Area: Cancer Biology
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.