You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human RANKL protein
Catalog Number: orb594839
| Catalog Number | orb594839 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor ligand superfamily member 11(TNFSF11),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Protein Length | Partial |
| UniProt ID | O14788 |
| MW | 22.4 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Loaded Recombinant Human OPG-Fc on Pro A Biosensor, can bind Human RANKL with an affinity constant of 1.83 pM as determined in BLI assay. ②Loaded Human RANK-His on HIS1K Biosensor, can bind Human RANK L with an affinity constant of < 1 pM as determined in BLI assay. |
| Expression Region | 140-317aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteocla Read more... |
| Background | CD254, also known as RANKL, TNFSF11, TRANCE, OPGL Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 4
Human TNFSF11 Protein, hFc Tag [orb757436]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 48.4 kDa after removal of the signal peptide.The apparent molecular mass of hFc-TNFSF11 is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg 
Human RANKL protein [orb392615]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μgRecombinant Human CD254/RANKL/TNFSF11 Protein, N-Fc [orb2834536]
> 90% as determined by SDS-PAGE.
48.32 kDa
100 μg, 50 μg, 20 μgRecombinant Human CD254/RANKL/TNFSF11 Protein, N-His [orb2837072]
> 90% as determined by SDS-PAGE.
30.67 kDa
100 μg, 50 μg, 20 μg
