You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245151 |
---|---|
Category | Proteins |
Description | Recombinant human Nucleoside diphosphate kinase A |
Reactivity | Human |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 44 kDa |
Target | NME1 |
UniProt ID | P15531 |
Protein Sequence | ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | 2-152aa |
Expression Region | 2-152aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | NME1 NDPKA NM23 Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
Human | |
18.75 pg/mL-1200 pg/mL | |
4.68 pg/mL |
Unconjugated | |
98% | |
18.0 kDa | |
Human NME1, His Tag (orb257714) is expressed from E.coli cells. It contains AA Ala 2 - Glu 152 (Accession # AAH00293). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
Greater than 90% as determined by SDS-PAGE. | |
44 kDa | |
E.coli |
Filter by Rating