You have no items in your shopping cart.
Cart summary
Human CEACAM6 protein
Catalog Number: orb383282
| Catalog Number | orb383282 |
|---|---|
| Category | Proteins |
| Description | Recombinant human CEACAM6 protein. |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 47.2 kDa |
| UniProt ID | P40199 |
| Protein Sequence | KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Expression System | Expression Region: 35-320aa. Protein Length: Full Length of Mature Protein |
| Expression Region | 35-320aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Non-specific crossreacting antigen, Normal cross-r Read more... |
| Note | For research use only |
| Application notes | E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CEACAM-6 / CD66c Protein [orb257336]
Unconjugated
95%
32.0 kDa
Human CEACAM-6, His Tag (orb257336) is expressed from human 293 cells (HEK293). It contains AA Lys 35 - Gly 320 (Accession # NP_002474.3).
1 mg, 100 μg Human CEACAM6 Protein, His Tag [orb1173762]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 32.1 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6-His is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μgHuman CEACAM6 ELISA Kit [orb405954]
Human
0.83 ng/mL-20 ng/mL
0.33 ng/mL
48 t, 24T, 10 x 96 t, 96 t, 5 x 96 tHuman CEACAM6 Protein [orb1476703]
Greater than 95% as determined by SDS-PAGE.
32.6 kDa
Mammalian cell
20 μg, 100 μg, 1 mgRecombinant Human CD66C/CEACAM6 Protein, His Tag [orb1553392]
≥90% as determined by SDS-PAGE
This protein contains the human CEACAM6(Met1-Gly320) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars