You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594893 |
---|---|
Category | Proteins |
Description | Recombinant Human Carbonic anhydrase 1(CA1) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Liquid |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 29.93 kDa |
UniProt ID | P00915 |
Protein Sequence | ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 2-261aa. Protein Length: Full Length of Mature Protein |
Biological Activity | The esterase activity is determined to be greater than 500 pmol/min/ug |
Expression Region | 2-261aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | 0.2 μm filtered 12.5mM Tris-HCl, 75mM NaCl, pH 7.5. |
Alternative names | Carbonic Anhydrase 1; Carbonate Dehydratase I; Car Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
30.7 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
65.9 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
44.7 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
E. coli |
≥90% as determined by SDS-PAGE | |
This protein contains the human CA1(Ala2-Phe261) was fused with the C-terminal His Tag and expressed in E. coli. |
Filter by Rating