You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CA1 protein
Catalog Number: orb594893
| Catalog Number | orb594893 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Carbonic anhydrase 1(CA1) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 29.93 kDa |
| UniProt ID | P00915 |
| Protein Sequence | ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The esterase activity is determined to be greater than 500 pmol/min/ug |
| Expression Region | 2-261aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0 |
| Alternative names | Carbonic Anhydrase 1; Carbonate Dehydratase I; Car Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 4
CA1 purified MaxPab rabbit polyclonal antibody (D01P) [orb2295254]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
- Item 1 of 1
Human BRCC3 protein [orb418706]
Greater than 90% as determined by SDS-PAGE.
65.9 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human CA1 protein [orb245770]
Greater than 90% as determined by SDS-PAGE.
30.7 kDa
Yeast
1 mg, 100 μg, 20 μg - Item 1 of 1
Human CA1 protein [orb244058]
Greater than 90% as determined by SDS-PAGE.
44.7 kDa
E.coli
20 μg, 100 μg, 1 mg
