CA1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295254
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CA1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: CA1 (NP_001729.1, 1 a.a. ~ 261 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
• NCBI: NP_001729.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA1 expression in human colon.

CA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA1 expression in human placenta.

CA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA1 expression in mouse brain.

Western Blot analysis of CA1 expression in transfected 293T cell line by CA1 MaxPab polyclonal antibody. Lane 1: CA1 transfected lysate(28.90 KDa). Lane 2: Non-transfected lysate.