HSD11B2 Antibody

• Catalog Number: orb316541
• Category: Antibodies
• Description: HSD11B2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 44127 MW
• UniProt ID: P80365
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Corticosteroid 11-beta-dehydrogenase isozyme 2;1.1
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of HSD11B2 using anti-HSD11B2 antibody.Lane 1:rat kidney tissue;2:mouse kidney tissue;3:human placenta tissue.

IF analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a paraffin-embedded section of human placenta tissue.

IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a paraffin-embedded section of Mouse Pancreas tissue.

IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a paraffin-embedded section of Rat Pancreas tissue.

IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a paraffin-embedded section of Human Placenta tissue.

IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a frozen section of human placenta tissue.

IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a frozen section of mouse kidney tissue.

IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a frozen section of rat kidney tissue.