You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316541 |
---|---|
Category | Antibodies |
Description | HSD11B2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, IHC, IHC-Fr, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 44127 MW |
UniProt ID | P80365 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Corticosteroid 11-beta-dehydrogenase isozyme 2;1.1 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of HSD11B2 using anti-HSD11B2 antibody.Lane 1:rat kidney tissue;2:mouse kidney tissue;3:human placenta tissue.
IF analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a paraffin-embedded section of human placenta tissue.
IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a paraffin-embedded section of Mouse Pancreas tissue.
IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a paraffin-embedded section of Rat Pancreas tissue.
IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a paraffin-embedded section of Human Placenta tissue.
IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a frozen section of human placenta tissue.
IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a frozen section of mouse kidney tissue.
IHC analysis of HSD11B2 using anti-HSD11B2 antibody. HSD11B2 was detected in a frozen section of rat kidney tissue.
Filter by Rating