GPHB5 Protein, Mouse, Recombinant (His)

• Catalog Number: orb1977236
• Category: Proteins
• Description: Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. GPHB5 Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 13.3 kDa and the accession number is Q812B2.
• Tag: C-6xHis
• Purity: 98.00%
• Protein Sequence: SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI
• UniProt ID: Q812B2
• MW: 13.3 kDa (predicted)
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expression System: P. pastoris (Yeast)
• Biological Origin: Mouse
• Biological Activity: Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. GPHB5 Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 13.3 kDa and the accession number is Q812B2.
• Expression Region: 25-130 aa
• Storage: -20°C
• Note: For research use only