You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977236 |
---|---|
Category | Proteins |
Description | Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. GPHB5 Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 13.3 kDa and the accession number is Q812B2. |
Tag | C-6xHis |
Purity | 98.00% |
Protein Sequence | SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI |
UniProt ID | Q812B2 |
MW | 13.3 kDa (predicted) |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Mouse |
Biological Activity | Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. GPHB5 Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 13.3 kDa and the accession number is Q812B2. |
Expression Region | 25-130 aa |
Storage | -20°C |
Note | For research use only |
98.00% | |
19.3 kDa (predicted) |