You have no items in your shopping cart.
Cart summary
GPHB5 Protein, Mouse, Recombinant (His & Myc)
Catalog Number: orb1977235
| Catalog Number | orb1977235 |
|---|---|
| Category | Proteins |
| Description | Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 19.3 kDa (predicted) |
| UniProt ID | Q812B2 |
| Protein Sequence | SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. |
| Expression Region | 25-130 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
