You have no items in your shopping cart.
Cart summary
Item 1 of 1
EPYC Rabbit Polyclonal Antibody
Catalog Number: orb326564
| Catalog Number | orb326564 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to EPYC |
| Target | EPYC |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human EPYC |
| Protein Sequence | Synthetic peptide located within the following region: FYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELV |
| UniProt ID | Q99645 |
| MW | 35kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti DSPG3 antibody, anti PGLB antibody, anti Pg-L Read more... |
| Note | For research use only |
| NCBI | NP_004941 |
WB Suggested Anti-EPYC Antibody, Titration: 1.0 ug/mL, Positive Control: HepG2 Whole Cell.
- Item 1 of 1
- Item 1 of 1
