EPYC Peptide - N-terminal region

SKU: orb2001755

Description

EPYC Peptide - N-terminal region, also known as EPYC,DSPG3, PGLB, SLRR3B,, is a synthetic peptide designed for use in combination with EPYC Rabbit Polyclonal Antibody (orb327447). It corresponds to the sequence ESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPP and is supplied in a lyophilized powder. This peptide is for research use only.

Images & Validation

• Application Notes:
  This is a synthetic peptide designed for use in combination with EPYC Rabbit Polyclonal Antibody (orb327447). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

• Protein Sequence: Synthetic peptide located within the following region: ESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPP

Storage & Handling

• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EPYC,DSPG3, PGLB, SLRR3B,

Quick Database Links

UniProt

Q99645

RefSeq (Protein):NP_004941