EPHA2 Rabbit Polyclonal Antibody

• Catalog Number: orb588918
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EPHA2
• Target: EPHA2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EPHA2
• Protein Sequence: Synthetic peptide located within the following region: IYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGAS
• UniProt ID: P29317
• MW: 107 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ECK, CTPA, ARCC2, CTPP1, CTRCT6
• Research Area: Protein Biochemistry, Stem Cell & Developmental Bi
• Note: For research use only
• NCBI: NP_004422.2

Sample Tissue: Human HCT15 Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Rabbit Anti-EPHA2 Antibody, Catalog Number: orb588918, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.