You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EPHA2 |
| Target | EPHA2 |
| Protein Sequence | Synthetic peptide located within the following region: IYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGAS |
| Molecular Weight | 107 kDa |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−EphA2/3/4 (phospho Tyr588/596) rabbit pAb Antibody [orb767947]
ELISA, IF, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μlEphA2/3/4 rabbit pAb Antibody [orb765146]
ELISA, IF, WB
Human, Rat
Polyclonal
Unconjugated
50 μl, 100 μlEphA2 (phospho Tyr588) rabbit pAb Antibody [orb764181]
ELISA, WB
Human, Mouse
Polyclonal
Unconjugated
50 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human HCT15 Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Rabbit Anti-EPHA2 Antibody, Catalog Number: orb588918, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_004422.2 |
|---|
Documents Download
Request a Document
EPHA2 Rabbit Polyclonal Antibody (orb588918)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

















