DDAH1 Antibody

• Catalog Number: orb371734
• Category: Antibodies
• Description: DDAH1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, RatImmunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 31122 MW
• UniProt ID: O94760
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: N (G),N (G)-dimethylarginine dimethylaminohydrolas
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-DDAH1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of DDAH1 using anti-DDAH1 antibody.Lane 1:rat kidney tissue;2:mouse kidney tissue;3:HELA cell.

IF analysis of DDAH1 using anti-DDAH1 antibody. DDAH1 was detected in immunocytochemical section of U20S cells.

IHC analysis of DDAH1 using anti-DDAH1 antibody.DDAH1 was detected in paraffin-embedded section of mouse brain tissues.

IHC analysis of DDAH1 using anti-DDAH1 antibody.DDAH1 was detected in paraffin-embedded section of rat brain tissues.