You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820876 |
---|---|
Category | Proteins |
Description | The Canine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP) (Gene ID: 403850). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 8.6 kDa |
Target | IL-8 |
Entrez | 403850 |
Protein Sequence | VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
Protein Length | 74 |
Source | Yeast |
Storage | -20°C |
Alternative names | CXCL8 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 95 % by SDS-PAGE and HPLC analyses. | |
Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 79 amino acids. | |
Escherichia coli |
SDS-PAGE | |
Unconjugated | |
> 95% by SDS-PAGE and HPLC analyses. | |
9.1 kDa | |
E. coli |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
9.1 KDa | |
E.Coli |
Filter by Rating