You have no items in your shopping cart.
Cart summary
Item 1 of 1
C19orf18 Rabbit Polyclonal Antibody
Catalog Number: orb581910
| Catalog Number | orb581910 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to C19orf18 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf18 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 24kDa |
| Target | C19orf18 |
| UniProt ID | Q8NEA5 |
| Protein Sequence | Synthetic peptide located within the following region: NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK |
| NCBI | NP_689687 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | MGC41906 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-C19orf18 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.
- Item 1 of 3
C19orf18 Antibody (Center) [orb1927703]
FC, IHC-P, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl 
