Cart summary

You have no items in your shopping cart.

C19orf18 Rabbit Polyclonal Antibody (FITC)

C19orf18 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2108418

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108418
CategoryAntibodies
DescriptionC19orf18 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C19orf18
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW24kDa
UniProt IDQ8NEA5
Protein SequenceSynthetic peptide located within the following region: NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK
NCBINP_689687
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMGC41906
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.