Bovine VEGF-A Recombinant Protein

• Catalog Number: orb1820902
• Category: Proteins
• Description: The Bovine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 19.2 kDa
• Target: VEGF-A
• Entrez: 281572
• Protein Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Protein Length: 164
• Source: Yeast
• Storage: -20°C
• Note: For research use only
• Expiration Date: 6 months from date of receipt.