beta 1 Adrenergic Receptor antibody

• Catalog Number: orb329873
• Category: Antibodies
• Description: Rabbit polyclonal antibody to beta 1 Adrenergic Receptor
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADRB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51 kDa
• Target: ADRB1
• UniProt ID: P08588
• Protein Sequence: Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
• NCBI: NP_000675
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti-ADR B1 antibody, anti-ADRB 1 antibody, anti-A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human brain tissue using ADRB1 antibody

Western blot analysis of Wild type mouse, left ventricle tissue using ADRB1 antibody

Western blot analysis of human Placenta tissue using ADRB1 antibody

Western blot analysis of human Fetal Heart tissue using ADRB1 antibody