GRK2/GRK2 Antibody

• Catalog Number: orb402466
• Category: Antibodies
• Description: GRK2/GRK2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 79 kDa
• UniProt ID: P25098
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Beta-adrenergic receptor kinase 1; Beta-ARK-1; G-p
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U87 cells using anti-GRK2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of GRK2 using anti-GRK2 antibody.Lane 1:rat spleen tissue;2:rat stomach tissue;3:mouse lung tissue;4:mouse liver tissue;5:mouse pancreas tissue.

IF analysis of GRK2 using anti-GRK2 antibody. GRK2 was detected in immunocytochemical section of U20S cells.

IHC analysis of GRK2 using anti-GRK2 antibody.GRK2 was detected in paraffin-embedded section of human Lung cancer tissues.

IHC analysis of GRK2 using anti-GRK2 antibody.GRK2 was detected in paraffin-embedded section of mouse spleen tissues.

IHC analysis of GRK2 using anti-GRK2 antibody.GRK2 was detected in paraffin-embedded section of rat spleen tissues.