BamA Protein, E. coli, Recombinant (His)

• Catalog Number: orb1979214
• Category: Proteins
• Description: BamA Protein, E. coli, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 30 kDa and the accession number is P0A940.
• Tag: C-6xHis
• Purity: 85.00%
• Protein Sequence: AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG
• UniProt ID: P0A940
• MW: 30 kDa (predicted)
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expression System: P. pastoris (Yeast)
• Biological Origin: E. coli
• Biological Activity: BamA Protein, E. coli, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 30 kDa and the accession number is P0A940.
• Expression Region: 175-424 aa
• Storage: -20°C
• Note: For research use only