BamA Protein, E. coli O157:H7, Recombinant (His)

• Catalog Number: orb1979238
• Category: Proteins
• Description: Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. BamA Protein, E. coli O157:H7, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 47.6 kDa and the accession number is P0A942.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 47.6 kDa (predicted)
• UniProt ID: P0A942
• Protein Sequence: RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW
• Expression System: E. coli
• Biological Origin: E. coli
• Biological Activity: Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. BamA Protein, E. coli O157:H7, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 47.6 kDa and the accession number is P0A942.
• Expression Region: 421-810 aa
• Storage: -20°C
• Note: For research use only
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expiration Date: 6 months from date of receipt.