You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1979238 |
---|---|
Category | Proteins |
Description | Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. BamA Protein, E. coli O157:H7, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 47.6 kDa and the accession number is P0A942. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | RNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW |
UniProt ID | P0A942 |
MW | 47.6 kDa (predicted) |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expression System | E. coli |
Biological Origin | E. coli |
Biological Activity | Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. BamA Protein, E. coli O157:H7, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 47.6 kDa and the accession number is P0A942. |
Expression Region | 421-810 aa |
Storage | -20°C |
Note | For research use only |