You have no items in your shopping cart.
Cart summary
anti-Spike RBD Domain (SARS-CoV-2)
Catalog Number: orb1463332
| Catalog Number | orb1463332 |
|---|---|
| Category | Antibodies |
| Description | The spike or S glycoprotein is a transmembrane protein with a molecular weight of about 150 kDa found in the outer portion of the SARS-CoV-2 virus. This protein is composed of two subunits, S1 and S2 and plays a key role in the receptor recognition and cell membrane fusion process. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion. |
| Species/Host | Goat |
| Clonality | Polyclonal |
| Tested applications | WB |
| Reactivity | Virus |
| Isotype | IgG |
| Immunogen | Antigen: Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 320 to 420) and produced in E. coli.. Antigen Sequence: NATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF |
| Antibody Type | Primary Antibody |
| Concentration | 1 mg/ml |
| Dilution range | WB:1:500-1:2,000 |
| Conjugation | Unconjugated |
| Target | Spike RBD Domain (SARS-CoV-2) |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Alternative names | S glycoprotein SARS Coronavirus-2, Spike RBD Domai Read more... |
| Note | For research use only |
| Application notes | The antibody solution should be gently mixed before use. |
| Expiration Date | 12 months from date of receipt. |
