You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1463312 |
---|---|
Category | Antibodies |
Description | The spike or S glycoprotein is a transmembrane protein with a molecular weight of about 150 kDa found in the outer portion of the SARS-CoV-2 virus. This protein is composed of two subunits, S1 and S2 and plays a key role in the receptor recognition and cell membrane fusion process. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion. |
Species/Host | Goat |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Virus |
Isotype | IgG |
Immunogen | Antigen: Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 343 to 400) and produced in E. coli.. Antigen Sequence: MQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADV |
Antibody Type | Primary Antibody |
Concentration | 1 mg/ml |
Dilution range | WB:1:500-1:2,000 |
Conjugation | Unconjugated |
Target | Spike RBD Domain (SARS-CoV-2) |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
Alternative names | S glycoprotein SARS Coronavirus-2, Spike RBD Domai Read more... |
Note | For research use only |
Application notes | The antibody solution should be gently mixed before use. |
Expiration Date | 12 months from date of receipt. |