Cart summary

You have no items in your shopping cart.

anti-Spike RBD Domain (SARS-CoV-2)

anti-Spike RBD Domain (SARS-CoV-2)

Catalog Number: orb1463309

DispatchUsually dispatched within 2-3 weeks
$ 280.00
Catalog Numberorb1463309
CategoryAntibodies
DescriptionThe spike or S glycoprotein is a transmembrane protein with a molecular weight of about 150 kDa found in the outer portion of the SARS-CoV-2 virus. This protein is composed of two subunits, S1 and S2 and plays a key role in the receptor recognition and cell membrane fusion process. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion.
Species/HostGoat
ClonalityPolyclonal
Tested applicationsWB
ReactivityVirus
IsotypeIgG
ImmunogenAntigen: Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 343 to 400) and produced in E. coli.. Antigen Sequence: NATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
Antibody TypePrimary Antibody
Concentration1 mg/ml
Dilution rangeWB:1:500-1:2,000
ConjugationUnconjugated
TargetSpike RBD Domain (SARS-CoV-2)
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesPBS, 20% glycerol and 0.05% sodium azide
Alternative namesS glycoprotein SARS Coronavirus-2, Spike RBD Domai
Read more...
NoteFor research use only
Application notesThe antibody solution should be gently mixed before use.
Expiration Date12 months from date of receipt.