You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977448 |
---|---|
Category | Proteins |
Description | 14-3-3 beta/alpha Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 30.1 kDa and the accession number is Q9CQV8. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN |
UniProt ID | Q9CQV8 |
MW | 30.1 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Mouse |
Biological Activity | 14-3-3 beta/alpha Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 30.1 kDa and the accession number is Q9CQV8. |
Expression Region | 1-246 aa |
Storage | -20°C |
Note | For research use only |
98.00% | |
33.6 kDa (predicted) |