You have no items in your shopping cart.
Cart summary
14-3-3 beta/alpha Protein, Mouse, Recombinant (E. coli, His)
Catalog Number: orb1977449
| Catalog Number | orb1977449 |
|---|---|
| Category | Proteins |
| Description | 14-3-3 beta/alpha Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 33.6 kDa and the accession number is Q9CQV8. |
| Tag | N-10xHis |
| Purity | 98.00% |
| Protein Sequence | MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN |
| UniProt ID | Q9CQV8 |
| MW | 33.6 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | 14-3-3 beta/alpha Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 33.6 kDa and the accession number is Q9CQV8. |
| Expression Region | 1-246 aa |
| Storage | -20°C |
| Note | For research use only |
