ZSCAN29 Rabbit Polyclonal Antibody

SKU: orb324741

Description

ZSCAN29 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ZSCAN29. It is suitable for WB application. The immunogen for Anti-ZSCAN29 antibody is: synthetic peptide directed towards the middle region of Human ZSC29. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZSCAN29 antibody is: synthetic peptide directed towards the middle region of Human ZSC29
• Target: ZSCAN29
• Protein Sequence: Synthetic peptide located within the following region: GRPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKER
• Molecular Weight: 50 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ZNF690 antibody, anti Zfp690 antibody

WB Suggested Anti-ZSC29 antibody Titration: 1 ug/mL, Sample Type: Human RPMI-8226 Whole Cell.

Quick Database Links

Gene Symbol

ZSCAN29

UniProt

Q8IWY8