ZRSR2 Rabbit Polyclonal Antibody

SKU: orb577666

Description

Rabbit polyclonal antibody to ZRSR2

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZRSR2
• Target: ZRSR2
• Protein Sequence: Synthetic peptide located within the following region: LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP
• Molecular Weight: 58kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

URP, ZC3H22, U2AF1L2, U2AF1RS2, U2AF1-RS2

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 0.5 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-ZRSR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Spleen.

Quick Database Links

Gene Symbol

ZRSR2

UniProt

Q15696

RefSeq (Protein):NP_005080