Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FLJ20729 Rabbit Polyclonal Antibody

SKU: orb324556

Description

FLJ20729 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ZNHIT6. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ20729. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FLJ20729
TargetZNHIT6
Protein SequenceSynthetic peptide located within the following region: PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVK
Molecular Weight54kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti BCD1 antibody, anti C1orf181 antibody, anti NY-BR-75 antibody, anti FLJ20729 antibody

Similar Products

  • FLJ20729 Rabbit Polyclonal Antibody (Biotin) [orb2134769]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • FLJ20729 Rabbit Polyclonal Antibody (HRP) [orb2134770]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • FLJ20729 Rabbit Polyclonal Antibody (FITC) [orb2134771]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FLJ20729 Rabbit Polyclonal Antibody

Human Intestine

FLJ20729 Rabbit Polyclonal Antibody

WB Suggested Anti-FLJ20729 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, ZNHIT6 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_060423

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

FLJ20729 Rabbit Polyclonal Antibody (orb324556)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry