ZNF92 Rabbit Polyclonal Antibody

• Catalog Number: orb575859
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF92
• Target: ZNF92
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF92
• Protein Sequence: Synthetic peptide located within the following region: KPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKL
• UniProt ID: Q03936
• MW: 60kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TF12, HPF12, HTF12, HEL-203
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_009070

WB Suggested Anti-ZNF92 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.