ZNF587 Rabbit Polyclonal Antibody

• Catalog Number: orb577260
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF587
• Target: ZNF587
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF587
• Protein Sequence: Synthetic peptide located within the following region: CGKSFSECSSLIKHRRIHTGERPYECTKCGKTFQRSSTLLHHQSSHRRKA
• UniProt ID: Q96SQ5
• MW: 65kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ZF6
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_116217

WB Suggested Anti-ZNF587 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.