ZNF580 Rabbit Polyclonal Antibody

SKU: orb577023

Description

Rabbit polyclonal antibody to ZNF580

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF580
• Target: ZNF580
• Protein Sequence: Synthetic peptide located within the following region: KAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQRE
• Molecular Weight: 19kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Positive control (+): RPMI-8226 (N12), Negative control (-): U937 (N31), Antibody concentration: 3 ug/ml.

Human Stomach

WB Suggested Anti-ZNF580 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

ZNF580

UniProt

Q9UK33

RefSeq (Protein):NP_057286