ZNF576 Rabbit Polyclonal Antibody

SKU: orb324579

Description

ZNF576 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ZNF576. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human ZN576. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZN576
• Target: ZNF576
• Protein Sequence: Synthetic peptide located within the following region: TCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQA
• Molecular Weight: 18kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ZNF576 antibody, anti antibody

Quick Database Links

Gene Symbol

ZNF576

UniProt

Q9H609

RefSeq (Protein):NP_077303