ZNF419A Rabbit Polyclonal Antibody

• Catalog Number: orb324808
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF419
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF419A
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 59kDa
• Target: ZNF419
• UniProt ID: Q96HQ0
• Protein Sequence: Synthetic peptide located within the following region: GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ
• NCBI: NP_078967
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ZNF419A antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-ZNF419A Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.