ZNF394 Rabbit Polyclonal Antibody

• Catalog Number: orb573568
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF394
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF394
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: ZNF394
• UniProt ID: Q53GI3
• Protein Sequence: Synthetic peptide located within the following region: GPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWEPNYPAASPDPETSRLH
• NCBI: NP_115540
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ZSCAN46, ZKSCAN14
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-ZNF394 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-ZNF394 Antibody, Paraffin Embedded Tissue: Human Pancreas, Cellular Data: Epithelial cells of pancreatic acinus, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ZNF394 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.