You have no items in your shopping cart.
Description
Research Area
Epigenetics & Chromatin
Images & Validation
−
Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF329 |
| Target | ZNF329 |
| Protein Sequence | Synthetic peptide located within the following region: SFKQNSHLAVHQRLHSREGPSRCPQCGKMFQKSSSLVRHQRAHLGEQPME |
| Molecular Weight | 62kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−FLJ12586
Similar Products
−- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
ZNF329 (D123) polyclonal antibody [orb650862]
IHC
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
25 μl, 200 μl, 100 μl, 50 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Available Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 3-7 working days