You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
ZNF320 Rabbit Polyclonal Antibody
Catalog Number: orb581256
| Catalog Number | orb581256 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZNF320 |
| Target | ZNF320 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF320 |
| Protein Sequence | Synthetic peptide located within the following region: NDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHT |
| UniProt ID | A2RRD8 |
| MW | 59kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ZFPL |
| Note | For research use only |
| NCBI | NP_997216 |
Positive control (+): Human Lung (LU), Negative control (-): Human Liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-ZNF320 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.
- Item 1 of 1
ZNF320 Rabbit Polyclonal Antibody [orb78070]
ELISA, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
