ZNF280D Rabbit Polyclonal Antibody

SKU: orb577054

Description

Rabbit polyclonal antibody to ZNF280D

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF280D
• Target: ZNF280D
• Protein Sequence: Synthetic peptide located within the following region: KSNSKMAELFMECEEEELEPWQKKVKEVEDDDDDEPIFVGEISSSKPAIS
• Molecular Weight: 65kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SUHW4, ZNF634

Sample Type: Fetal Brain lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-ZNF280D antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Quick Database Links

Gene Symbol

ZNF280D

UniProt

Q6N043