ZNF236 Rabbit Polyclonal Antibody

SKU: orb574727

Description

Rabbit polyclonal antibody to ZNF236

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF236
• Target: ZNF236
• Protein Sequence: Synthetic peptide located within the following region: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ
• Molecular Weight: 204kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ZNF236A, ZNF236B

Rabbit Anti-ZNF236 Antibody, Catalog Number: orb574727, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Nuclear in hepatocytes, moderate signal, moderate tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-ZNF236 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate, ZNF236 is supported by BioGPS gene expression data to be expressed in HepG2.

Quick Database Links

Gene Symbol

ZNF236

UniProt

Q9UL36

RefSeq (Protein):NP_031371