ZNF197 Rabbit Polyclonal Antibody

• Catalog Number: orb576874
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF197
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF197
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: ZNF197
• UniProt ID: Q86VG0
• Protein Sequence: Synthetic peptide located within the following region: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY
• NCBI: NP_001020026
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P18, VHLaK, ZNF20, ZNF166, ZKSCAN9, ZSCAN41, D3S13
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Muscle

WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.