ZNF121 Rabbit Polyclonal Antibody

SKU: orb581062

Description

ZNF121 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ZNF121. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human ZNF121. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF121
• Target: ZNF121
• Protein Sequence: Synthetic peptide located within the following region: LTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKS
• Molecular Weight: 45kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ZHC32, ZNF20, D19S204

Quick Database Links

Gene Symbol

ZNF121

UniProt

P58317

RefSeq (Protein):NP_001008727