ZNF112 Rabbit Polyclonal Antibody

• Catalog Number: orb324773
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZFP112
• Target: ZNF112
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF228
• Protein Sequence: Synthetic peptide located within the following region: VTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLI
• UniProt ID: Q0VG01
• MW: 105kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Zfp112 antibody, anti ZNF228 antibody
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_037512

Sample Tissue: Human A172 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-ZNF228 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.