ZMIZ2 antibody

Catalog Number: orb584738

Catalog Number	orb584738
Category	Antibodies
Description	Rabbit polyclonal antibody to ZMIZ2
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Animal, Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Reactivity	Animal, Bovine, Guinea pig, Human, Mouse, Rat, Zebrafish
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	94kDa
Target	ZMIZ2
UniProt ID	Q8NF64
Protein Sequence	Synthetic peptide located within the following region: HYKPTRSIPGYPSSPLPGNPTPPMTPSSSVPYMSPNQEVKSPFLPDLKPN
NCBI	NP_777589
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	NET27, ZIMP7, hZIMP7, TRAFIP20 Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.