Zkscan14 Rabbit Polyclonal Antibody

SKU: orb324686

Description

Zkscan14 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Zkscan14. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Mouse samples and is predicted to react with Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Zkscan14
• Protein Sequence: Synthetic peptide located within the following region: SVKPHSSVDSAVGLLETQRQFQEDKPYKCDSCEKGFRQRSDLFKHQRIHT
• Molecular Weight: 59kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 2310046C23Rik antibody, anti 2810437E14Rik antibody, anti MGC117641 antibody, anti Zfp99 antibody, anti Znf394 antibody

Quick Database Links

Gene Symbol

Zkscan14

UniProt

Q9Z1D9

RefSeq (Protein):NP_075811