ZIC5 Rabbit Polyclonal Antibody

• Catalog Number: orb329734
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZIC5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZIC5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66kDa
• Target: ZIC5
• UniProt ID: Q96T25
• Protein Sequence: Synthetic peptide located within the following region: MEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRAAVAH
• NCBI: NP_149123
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-ZIC5 Antibody Titration: 0.125 ug/mL, Positive Control: Human cerebellum.