Zfp74 Rabbit Polyclonal Antibody

SKU: orb324824

Description

Zfp74 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Zfp74. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zfp74. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zfp74
• Target: Zfp74
• Protein Sequence: Synthetic peptide located within the following region: SNCGKAFSQISSLTLHMRKHTGEKPYVCIECGKAFSQKSHLVRHQRIHTH
• Molecular Weight: 77kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 2810054M15Rik antibody, anti KRAB8 antibody, anti Zfp66 antibody, anti Znf569 antibody, anti mszf21 antibody, anti mszf77 antibody

Quick Database Links

Gene Symbol

Zfp74

UniProt

Q80W31

RefSeq (Protein):NP_848471