ZFP36 Rabbit Polyclonal Antibody

SKU: orb576614

Description

Rabbit polyclonal antibody to ZFP36

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFP36
• Target: ZFP36
• Protein Sequence: Synthetic peptide located within the following region: PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
• Molecular Weight: 34kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TTP, G0S24, GOS24, TIS11, NUP475, zfp-36, RNF162A

IHC Information: Paraffin embedded small intestine, submucosal plexus tissue, tested with an antibody Dilution of 5 ug/ml.

WB Suggested Anti-ZFP36 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.

Quick Database Links

Gene Symbol

ZFP36

UniProt

P26651

RefSeq (Protein):NP_003398