ZA20D3 Rabbit Polyclonal Antibody

SKU: orb575098

Description

Rabbit polyclonal antibody to ZA20D3

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZA20D3
• Target: ZFAND6
• Protein Sequence: Synthetic peptide located within the following region: SDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHR
• Molecular Weight: 23kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AWP1, ZA20D3, ZFAND5B

Human kidney

WB Suggested Anti-ZA20D3 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, ZFAND6 is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

ZFAND6

UniProt

Q6FIF0

RefSeq (Protein):NP_061879