ZDHHC13 Rabbit Polyclonal Antibody

SKU: orb579157

Description

ZDHHC13 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ZDHHC13. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human ZDHHC13. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Immunology & Inflammation

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZDHHC13
• Target: ZDHHC13
• Protein Sequence: Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
• Molecular Weight: 54kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HIP14L, HIP3RP

Quick Database Links

Gene Symbol

ZDHHC13

UniProt

Q8IUH4

RefSeq (Protein):NP_001001483