C10orf56 Rabbit Polyclonal Antibody

SKU: orb326012

Description

C10orf56 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ZCCHC24. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human C10orf56. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf56
• Target: ZCCHC24
• Protein Sequence: Synthetic peptide located within the following region: LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL
• Molecular Weight: 27kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ90798 antibody, anti C10orf56 antibody

Quick Database Links

Gene Symbol

ZCCHC24

UniProt

Q8N2G6

RefSeq (Protein):NP_699198